PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Bv6_140290_joxm.t1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Chenopodiaceae; Betoideae; Beta
Family bZIP
Protein Properties Length: 165aa    MW: 19236.2 Da    PI: 6.1205
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Bv6_140290_joxm.t1genomeTBVRView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_148.42e-1548106563
                         CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
              bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                         +r+rr+++NRe+ArrsR RK+  ++eL   v  L +eN +L+++l++l++  +k  +e+
  Bv6_140290_joxm.t1  48 RRQRRMISNRESARRSRMRKQRHLDELWSQVIRLRNENNSLIDKLNHLSESHDKILQEN 106
                         79************************************************999988876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003388.1E-1644108IPR004827Basic-leucine zipper domain
PROSITE profilePS5021711.4546109IPR004827Basic-leucine zipper domain
SuperFamilySSF579593.16E-134898No hitNo description
Gene3DG3DSA:1.20.5.1701.4E-1248122No hitNo description
PfamPF001707.2E-1448106IPR004827Basic-leucine zipper domain
CDDcd147024.22E-1649100No hitNo description
PROSITE patternPS0003605166IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 165 aa     Download sequence    Send to blast
MQQATTTMND FNASFTNIYQ TSSPIYMSSN STSDESEEIQ QIQIIDERRQ RRMISNRESA  60
RRSRMRKQRH LDELWSQVIR LRNENNSLID KLNHLSESHD KILQENVRLK EEASDLRQMI  120
SNNVQLASTT YNAFRDLEDI PCTTAHLRAE SSNNQSISSS NDLLL
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
16067RRSRMRKQ
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010681295.11e-115PREDICTED: basic leucine zipper 43-like
SwissprotQ9FMC24e-36BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A0J8C8A51e-116A0A0J8C8A5_BETVU; Uncharacterized protein
STRINGPOPTR_0008s11260.16e-60(Populus trichocarpa)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.13e-34basic leucine-zipper 42